Recombinant Full Length Staphylococcus Aureus Sensor Protein Kinase Walk(Walk) Protein, His-Tagged
Cat.No. : | RFL28327SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein kinase walK(walK) Protein (Q2FKN7) (1-608aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-608) |
Form : | Lyophilized powder |
AA Sequence : | MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV IEDGDWDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | walK |
Synonyms | walK; SAUSA300_0021; Sensor protein kinase WalK |
UniProt ID | Q2FKN7 |
◆ Recombinant Proteins | ||
ROBO1-2415M | Recombinant Mouse ROBO1 Protein (880-1612 aa), His-tagged | +Inquiry |
CDK18-CCNY-45HFL | Active Recombinant Full Length Human CDK18 and CCNY co-expressed Protein, N-GST-tagged | +Inquiry |
VPS25-6540R | Recombinant Rat VPS25 Protein | +Inquiry |
SH-RS09925-5761S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS09925 protein, His-tagged | +Inquiry |
HSD3B2-23H | Recombinant Human HSD3B2 protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF829-756HCL | Recombinant Human ZNF829 lysate | +Inquiry |
STAT4-488HCL | Recombinant Human STAT4 cell lysate | +Inquiry |
GLA-2173HCL | Recombinant Human GLA cell lysate | +Inquiry |
UBQLN3-721HCL | Recombinant Human UBQLN3 lysate | +Inquiry |
FAM161A-6418HCL | Recombinant Human FAM161A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All walK Products
Required fields are marked with *
My Review for All walK Products
Required fields are marked with *
0
Inquiry Basket