Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhg2(Mnhg2) Protein, His-Tagged
Cat.No. : | RFL12337SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative antiporter subunit mnhG2(mnhG2) Protein (A6QET9) (1-145aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-145) |
Form : | Lyophilized powder |
AA Sequence : | MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhG2 |
Synonyms | mnhG2; mrpG2; NWMN_0599; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2 |
UniProt ID | A6QET9 |
◆ Recombinant Proteins | ||
VEGFA-3652P | Recombinant Pig VEGFA protein, His-tagged | +Inquiry |
HGF-963H | Recombinant Human HGF Protein, GST-tagged | +Inquiry |
TMEM150C-6124R | Recombinant Rat TMEM150C Protein | +Inquiry |
PDGFA-1044C | Active Recombinant Canine PDGFA protein(Ser87-Arg196), hFc-tagged | +Inquiry |
TDGF1P3-5090H | Recombinant Human TDGF1P3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHDPSL-6947HCL | Recombinant Human DHDPSL 293 Cell Lysate | +Inquiry |
NDP-3932HCL | Recombinant Human NDP 293 Cell Lysate | +Inquiry |
UBE2A-594HCL | Recombinant Human UBE2A 293 Cell Lysate | +Inquiry |
ABHD14B-9136HCL | Recombinant Human ABHD14B 293 Cell Lysate | +Inquiry |
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhG2 Products
Required fields are marked with *
My Review for All mnhG2 Products
Required fields are marked with *
0
Inquiry Basket