Recombinant Full Length Staphylococcus Aureus Potassium-Transporting Atpase B Chain 2(Kdpb2) Protein, His-Tagged
Cat.No. : | RFL2990SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Potassium-transporting ATPase B chain 2(kdpB2) Protein (Q6GEZ7) (1-675aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-675) |
Form : | Lyophilized powder |
AA Sequence : | MHHVNKYFNQTMVIEALKMSFYKLNPKQLIKNPIMFVVEVGMLLTLILICFPDIFGTSYL SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV MILDKTGTITYGNRIASEFLPVNQQMMEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESICMDVSS KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFAELRKMGIETVMCTGDNALTAATIAKEA GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP FLGIKLIDMIVQFFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB2 |
Synonyms | kdpB2; SAR2164; Potassium-transporting ATPase ATP-binding subunit 2; ATP phosphohydrolase [potassium-transporting] B chain 2; Potassium-binding and translocating subunit B 2; Potassium-translocating ATPase B chain 2 |
UniProt ID | Q6GEZ7 |
◆ Recombinant Proteins | ||
SSEG-RS08600-917S | Recombinant Streptomyces sviceus ATCC 29083 SSEG_RS08600 protein, His-tagged | +Inquiry |
Il4ra-1757M | Recombinant Mouse Interleukin 4 Receptor, Alpha, Fc-tagged | +Inquiry |
CEP152-1588M | Recombinant Mouse CEP152 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12435BF | Recombinant Full Length Bovine Collectin-12(Colec12) Protein, His-Tagged | +Inquiry |
Il13ra2-1761M | Recombinant Mouse Interleukin 13 Receptor, Alpha 2 | +Inquiry |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS7B-7354HCL | Recombinant Human COPS7B 293 Cell Lysate | +Inquiry |
ZNF556-2051HCL | Recombinant Human ZNF556 cell lysate | +Inquiry |
PNRC2-3064HCL | Recombinant Human PNRC2 293 Cell Lysate | +Inquiry |
LAMC1-4827HCL | Recombinant Human LAMC1 293 Cell Lysate | +Inquiry |
LRRTM1-4617HCL | Recombinant Human LRRTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdpB2 Products
Required fields are marked with *
My Review for All kdpB2 Products
Required fields are marked with *
0
Inquiry Basket