Recombinant Full Length Staphylococcus Aureus Potassium-Transporting Atpase B Chain 1(Kdpb1) Protein, His-Tagged
Cat.No. : | RFL5706SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Potassium-transporting ATPase B chain 1(kdpB1) Protein (P0A008) (1-673aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-673) |
Form : | Lyophilized powder |
AA Sequence : | MAETTKIFESHLVKQALKDSVLKLYPVYMIKNPIMFVVEVGMLLALGLTIYPDLFHQESV SRLYVFSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKARRIKQDGSYEMIDA SDLKKGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDFDNVIGGTSVA SDWLEVEITSEPGHSFLDKMIGLVEGATRKKTPNEIALFTLLMTLTIIFLVVILTMYPLA KFLNFNLSIAMLIALAVCLIPTTIGGLLSAIGIAGMDRVTQFNILAKSGRSVETCGDVNV LILDKTGTITYGNRMADAFIPVKSSSFERLVKAAYESSIADDTPEGRSIVKLAYKQHIDL PQEVGEYIPFTAETRMSGVKFTTREVYKGAPNSMVKRVKEAGGHIPVDLDALVKGVSKKG GTPLVVLEDNEILGVIYLKDVIKDGLVERFRELREMGIETVMCTGDNELTAATIAKEAGV DRFVAECKPEDKINVIREEQAKGHIVAMTGDGTNDAPALAEANVGLAMNSGTMSAKEAAN LIDLDSNPTKLMEVVLIGKQLLMTRGSLTTFSIANDIAKYFAILPAMFMAAMPAMNHLNI MHLHSPESAVLSALIFNALIIVLLIPIAMKGVKFKGASTQTILMKNMLVYGLGGMIVPFI GIKLIDLIIQLFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB1 |
Synonyms | kdpB1; SA0070; Potassium-transporting ATPase ATP-binding subunit 1; ATP phosphohydrolase [potassium-transporting] B chain 1; Potassium-binding and translocating subunit B 1; Potassium-translocating ATPase B chain 1 |
UniProt ID | P0A008 |
◆ Recombinant Proteins | ||
Vrk1-5795M | Recombinant Mouse Vrk1 protein, His&Myc-tagged | +Inquiry |
RAN-17H | Active Recombinant Human RAN protein, His-tagged | +Inquiry |
DDR1-1819H | Recombinant Human DDR1 protein, GST-tagged | +Inquiry |
VNN1-2671H | Active Recombinant Human VNN1 protein, His-tagged | +Inquiry |
RPLT-1658S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 RPLT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf74-8335HCL | Recombinant Human C11orf74 293 Cell Lysate | +Inquiry |
C8orf22-7954HCL | Recombinant Human C8orf22 293 Cell Lysate | +Inquiry |
GPN1-1934HCL | Recombinant Human GPN1 cell lysate | +Inquiry |
HAVCR1-2486CCL | Recombinant Canine HAVCR1 cell lysate | +Inquiry |
CAMK1D-7882HCL | Recombinant Human CAMK1D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdpB1 Products
Required fields are marked with *
My Review for All kdpB1 Products
Required fields are marked with *
0
Inquiry Basket