Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit E1(Mnhe1) Protein, His-Tagged
Cat.No. : | RFL36718SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Na(+)/H(+) antiporter subunit E1(mnhE1) Protein (Q2FIC7) (1-159aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-159) |
Form : | Lyophilized powder |
AA Sequence : | MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhE1 |
Synonyms | mnhE1; SAUSA300_0851; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1 |
UniProt ID | Q2FIC7 |
◆ Native Proteins | ||
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
IgG-010E | Native Horse Whole Molecule IgG, Biotin Conjugated | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
MYH-10B | Active Native Bovine Myosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOC2-8823HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
EPHA2-1072HCL | Recombinant Human EPHA2 cell lysate | +Inquiry |
FBXW5-610HCL | Recombinant Human FBXW5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mnhE1 Products
Required fields are marked with *
My Review for All mnhE1 Products
Required fields are marked with *
0
Inquiry Basket