Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL35898SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q2G093) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; yfnI; SAOUHSC_00728; Lipoteichoic acid synthase |
UniProt ID | Q2G093 |
◆ Recombinant Proteins | ||
MAGEA1-28H | Recombinant Human MAGEA1 Protein, GST-tagged | +Inquiry |
MALSU1-964H | Recombinant Human MALSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCYT2-126H | Recombinant Human PCYT2 protein, MYC/DDK-tagged | +Inquiry |
GK-3238H | Recombinant Human GK protein, His-tagged | +Inquiry |
RFL11629CF | Recombinant Full Length Dog Gonadotropin-Releasing Hormone Receptor(Gnrhr) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL54-4155HCL | Recombinant Human MRPL54 293 Cell Lysate | +Inquiry |
MRPS18A-419HCL | Recombinant Human MRPS18A lysate | +Inquiry |
DOK1-6848HCL | Recombinant Human DOK1 293 Cell Lysate | +Inquiry |
RWDD2A-2103HCL | Recombinant Human RWDD2A 293 Cell Lysate | +Inquiry |
RNF34-2279HCL | Recombinant Human RNF34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket