Recombinant Full Length Dog Gonadotropin-Releasing Hormone Receptor(Gnrhr) Protein, His-Tagged
Cat.No. : | RFL11629CF |
Product Overview : | Recombinant Full Length Dog Gonadotropin-releasing hormone receptor(GNRHR) Protein (Q9MZI6) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MASASPEQNQNHCSAVNNSNMLMQGNLPTLTLSGKIRVTVTFFLFLLSTIFNASFLLKLQ KWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLK LFSMYAPAFMMVVISLDRSLAITRPLAMKNNGKLGQSMIGLAWLLSGIFAGPQLYIFRMI HLADSSGQTEGFPQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLFITLICNAKIIFTLTRV LHQDPHELQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRVS DPVNHFFFLFALLNPCFDPLIYGYFSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GNRHR |
Synonyms | GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R |
UniProt ID | Q9MZI6 |
◆ Recombinant Proteins | ||
TOMM20-7601H | Recombinant Human TOMM20, His-tagged | +Inquiry |
TIMP1-4722R | Recombinant Rhesus monkey TIMP1 Protein, His-tagged | +Inquiry |
FITM2-1715R | Recombinant Rhesus monkey FITM2 Protein, His-tagged | +Inquiry |
Pclo-1926R | Recombinant Rat Pclo Protein, His-tagged | +Inquiry |
LILRB3-7060H | Recombinant Human LILRB3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF202-124HCL | Recombinant Human ZNF202 293 Cell Lysate | +Inquiry |
ECSIT-241HCL | Recombinant Human ECSIT lysate | +Inquiry |
BRPF3-182HCL | Recombinant Human BRPF3 cell lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
ADAMTSL5-8HCL | Recombinant Human ADAMTSL5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GNRHR Products
Required fields are marked with *
My Review for All GNRHR Products
Required fields are marked with *
0
Inquiry Basket