Recombinant Full Length Staphylococcus Aureus Holin-Like Protein Cidb(Cidb) Protein, His-Tagged
Cat.No. : | RFL6478SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Holin-like protein CidB(cidB) Protein (Q6GDQ8) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLIILFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cidB |
Synonyms | cidB; SAR2620; Holin-like protein CidB |
UniProt ID | Q6GDQ8 |
◆ Native Proteins | ||
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEH-8798HCL | Recombinant Human APEH 293 Cell Lysate | +Inquiry |
SLC44A2-1712HCL | Recombinant Human SLC44A2 293 Cell Lysate | +Inquiry |
BEST1-1910HCL | Recombinant Human BEST1 cell lysate | +Inquiry |
SCUBE1-2018HCL | Recombinant Human SCUBE1 293 Cell Lysate | +Inquiry |
ZNF606-38HCL | Recombinant Human ZNF606 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cidB Products
Required fields are marked with *
My Review for All cidB Products
Required fields are marked with *
0
Inquiry Basket