Recombinant Full Length Staphylococcus Aureus Heme Sensor Protein Hsss(Hsss) Protein, His-Tagged
Cat.No. : | RFL15718SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Heme sensor protein hssS(hssS) Protein (A5IVE3) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP THIQQYFKHLGQMNYQIMTVDQKGHKTFYGEPFREDTLSQNAINNVLNNKDYHGIKDKPF ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE LDNHQHLLFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hssS |
Synonyms | hssS; SaurJH9_2386; Heme sensor protein HssS |
UniProt ID | A5IVE3 |
◆ Recombinant Proteins | ||
PSMA3-5429H | Recombinant Human PSMA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAMD4-14653M | Recombinant Mouse SAMD4 Protein | +Inquiry |
GALNT4-1808R | Recombinant Rhesus monkey GALNT4 Protein, His-tagged | +Inquiry |
RFL36800GF | Recombinant Full Length Gadus Morhua Melanopsin-A(Opn4A) Protein, His-Tagged | +Inquiry |
Il6ra-583M | Recombinant Mouse Il6ra protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
CPB2-27270TH | Native Human CPB2 | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB4-3274HCL | Recombinant Human PFKFB4 293 Cell Lysate | +Inquiry |
SHOX-1603HCL | Recombinant Human SHOX cell lysate | +Inquiry |
NCEH1-3951HCL | Recombinant Human NCEH1 293 Cell Lysate | +Inquiry |
SERINC1-1944HCL | Recombinant Human SERINC1 293 Cell Lysate | +Inquiry |
DNAJC11-495HCL | Recombinant Human DNAJC11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hssS Products
Required fields are marked with *
My Review for All hssS Products
Required fields are marked with *
0
Inquiry Basket