Recombinant Full Length Staphylococcus Aureus Heme Sensor Protein Hsss(Hsss) Protein, His-Tagged
Cat.No. : | RFL33907SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Heme sensor protein hssS(hssS) Protein (Q99RR5) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP THIQQYFKHLGQMNYQIMTVDQKGHKTFYGEPFREDTLSQNAINNVLNNKDYHGIKDKPF ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE LDNHQHLLFDDKIQVDQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hssS |
Synonyms | hssS; SAV2362; Heme sensor protein HssS |
UniProt ID | Q99RR5 |
◆ Recombinant Proteins | ||
ITGAV&ITGB8-367H | Active Recombinant Human ITGAV & ITGB8 Heterodimer Protein, His & Avi-tagged, Biotinylated | +Inquiry |
EBF4-4143HF | Recombinant Full Length Human EBF4 Protein, GST-tagged | +Inquiry |
IP6K1-2740R | Recombinant Rat IP6K1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPCAM-785HF | Recombinant Human EPCAM protein, His-tagged, FITC-Labeled | +Inquiry |
RFL8205MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 7(Ccr7) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-078P | Native Porcine Mucin Protein | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Throat-521C | Cynomolgus monkey Throat Lysate | +Inquiry |
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
BBS9-8500HCL | Recombinant Human BBS9 293 Cell Lysate | +Inquiry |
GALR3-6027HCL | Recombinant Human GALR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hssS Products
Required fields are marked with *
My Review for All hssS Products
Required fields are marked with *
0
Inquiry Basket