Recombinant Full Length Solanum Lycopersicum Serine/Threonine-Protein Phosphatase 5(Pp5) Protein, His-Tagged
Cat.No. : | RFL9933SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum Serine/threonine-protein phosphatase 5(PP5) Protein (Q84K11) (1-556aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-556) |
Form : | Lyophilized powder |
AA Sequence : | MPGMEAENSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTK LEEYGSAIQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDATK KLKECEKAVMKLKFEEAISVPESQRRSVADSIDYRSVGSGPGSSYVPTKTTAVSAAAALM GVLVVYMGTKAATMVAAAASAALLVVLITFLWGRCSDGFFTKSRTLELEVEPQYAGARIE GDVVTLDFVKKMLDDFKNQKNLHKRYAYQIVLQTREMLRALPSLVDIVVPEGKHFTVCGD VHGQFYDLLNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMCPSAIHLARG NHESKSMNKIYGFEGEVRSKLSEIFVELFAEVFCCLPLAHVINEKVFVVHGGLFSVDGVK LSDIRAIDRFCEPPEEGLMCELLWSDPQPQPGRGPSKRGVGLSFGGDVTKRFLQENNLDL VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHP DVKPMAYANNFLRMFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PP5 |
Synonyms | PP5; Serine/threonine-protein phosphatase 5; LePP5 |
UniProt ID | Q84K11 |
◆ Recombinant Proteins | ||
GSDMC-5402H | Recombinant Human GSDMC Protein, GST-tagged | +Inquiry |
PPNK-1313S | Recombinant Streptomyces coelicolor A3(2) PPNK protein, His-tagged | +Inquiry |
RDH11-1872H | Recombinant Human RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIBAN2-5622H | Recombinant Human NIBAN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT13-10964M | Recombinant Mouse NUDT13 Protein | +Inquiry |
◆ Native Proteins | ||
MB-236B | Native Bovine Myoglobin | +Inquiry |
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF821-4HCL | Recombinant Human ZNF821 293 Cell Lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
C20orf195-8121HCL | Recombinant Human C20orf195 293 Cell Lysate | +Inquiry |
IFNAR2-2243HCL | Recombinant Human IFNAR2 cell lysate | +Inquiry |
NGLY1-3835HCL | Recombinant Human NGLY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PP5 Products
Required fields are marked with *
My Review for All PP5 Products
Required fields are marked with *
0
Inquiry Basket