Recombinant Full Length Solanum Lycopersicum Chlorophyll A-B Binding Protein 7, Chloroplastic(Cab7) Protein, His-Tagged
Cat.No. : | RFL4940SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum Chlorophyll a-b binding protein 7, chloroplastic(CAB7) Protein (P10708) (43-270aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-270) |
Form : | Lyophilized powder |
AA Sequence : | SKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRW NQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIG WAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKE IKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CAB7 |
Synonyms | CAB7; Chlorophyll a-b binding protein 7, chloroplastic; LHCI type II CAB-7 |
UniProt ID | P10708 |
◆ Native Proteins | ||
ALPI-8341C | Native Calf ALPI | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
APCS-1269HCL | Recombinant Human APCS cell lysate | +Inquiry |
MRPL12-4197HCL | Recombinant Human MRPL12 293 Cell Lysate | +Inquiry |
HYAL1-5325HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
SF3B5-1915HCL | Recombinant Human SF3B5 293 Cell Lysate | +Inquiry |
WNT16-300HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CAB7 Products
Required fields are marked with *
My Review for All CAB7 Products
Required fields are marked with *
0
Inquiry Basket