Recombinant Full Length Danio Rerio Nucleolar Complex Protein 4 Homolog(Noc4L) Protein, His-Tagged
Cat.No. : | RFL11805DF |
Product Overview : | Recombinant Full Length Danio rerio Nucleolar complex protein 4 homolog(noc4l) Protein (Q4VBT2) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MAPSGDSNVKEHNNQVSYKKAINTKTDLILQNKKHANDIFDVIEYLQSEKEKEIIFATNA CSKIFCELIERGDLFVGELPKEEDLAQGDRSAEEKYHIFMRHRYNSCVELMLENVSHESF QVKETSLCAVMKFVATEGKHPLQNLDWSEHYNFPRELIQALVEHLLSEKEDMSLLISRFQ EFMEKDDVRYYVMSSVRYSTATVMERNKKAVIPVFQNNVFNLLTTINIPNQASEMTNFLV QQQSKHDDWKAAKLKEHKRAFEQMWLLFLRYKLPGSMYKKILVILHESILPQMSDPKLMM DFLSAAYDIGGAISLSALNGLFVPIHEHNLDYPDFYKKLYNLLDPSIFHVKYRARFFHLA NIFLSSTHLPVYLVAAFVKRLARLSLTAPPTALLILLPFICNLIRRHPSCRVLIHRPSAA DEPCDDPYVMEEEDPAQCHALESSLWEIKTLQNHHHPDVSKAATMINEPLSAQEEDISEL LELTTFELMERELKGEKKTVPLEFDMATDLLKSSREVLGVHFTLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | noc4l |
Synonyms | noc4l; zgc:110429; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein |
UniProt ID | Q4VBT2 |
◆ Recombinant Proteins | ||
AFAP1-3523H | Recombinant Human AFAP1 protein, His-tagged | +Inquiry |
MUC4-5763H | Recombinant Human MUC4 protein, His-tagged | +Inquiry |
PABPN1-403H | Recombinant Human poly(A) binding protein, nuclear 1, His-tagged | +Inquiry |
PPP2R2A-807C | Recombinant Cynomolgus PPP2R2A Protein, His-tagged | +Inquiry |
RFL9606EF | Recombinant Full Length Escherichia Coli O157:H7 Upf0059 Membrane Protein Yebn(Yebn) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS2-4260HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
KCNK1-5041HCL | Recombinant Human KCNK1 293 Cell Lysate | +Inquiry |
PDHA2-3333HCL | Recombinant Human PDHA2 293 Cell Lysate | +Inquiry |
SDSL-2003HCL | Recombinant Human SDSL 293 Cell Lysate | +Inquiry |
OAZ3-1243HCL | Recombinant Human OAZ3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All noc4l Products
Required fields are marked with *
My Review for All noc4l Products
Required fields are marked with *
0
Inquiry Basket