Recombinant Full Length Human CNDP2 Protein, C-Flag-tagged
Cat.No. : | CNDP2-829HFL |
Product Overview : | Recombinant Full Length Human CNDP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CNDP2 carnosine dipeptidase 2 [ Homo sapiens (human) ] |
Official Symbol | CNDP2 |
Synonyms | CN2; CPGL; PEPA; HsT2298; HEL-S-13 |
Gene ID | 55748 |
mRNA Refseq | NM_018235.3 |
Protein Refseq | NP_060705.2 |
MIM | 169800 |
UniProt ID | Q96KP4 |
◆ Recombinant Proteins | ||
Cndp2-2215M | Recombinant Mouse Cndp2 Protein, Myc/DDK-tagged | +Inquiry |
Cndp2-6314M | Recombinant Mouse Cndp2 Protein (Met1-Asn475), C-His tagged | +Inquiry |
CNDP2-858M | Recombinant Mouse CNDP2 protein(Met1-Asn475), His-tagged | +Inquiry |
CNDP2-4744H | Recombinant Human CNDP2 protein, His-tagged | +Inquiry |
CNDP2-627H | Recombinant Human CNDP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNDP2-641MCL | Recombinant Mouse CNDP2 cell lysate | +Inquiry |
CNDP2-637HCL | Recombinant Human CNDP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNDP2 Products
Required fields are marked with *
My Review for All CNDP2 Products
Required fields are marked with *
0
Inquiry Basket