Recombinant Full Length Shigella Sonnei Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL6892SF |
Product Overview : | Recombinant Full Length Shigella sonnei Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q3YUK4) (20-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella sonnei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-565) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSHFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVPQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTHLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGMLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPIFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKKFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; SSON_4319; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q3YUK4 |
◆ Recombinant Proteins | ||
NR5A2-6747HF | Recombinant Full Length Human NR5A2 Protein, GST-tagged | +Inquiry |
TSSK4-1094H | Recombinant Human TSSK4 Protein (G2-T328), His/GST tagged | +Inquiry |
TMPRSS11A-1360H | Recombinant Human TMPRSS11A protein, His-tagged | +Inquiry |
MED24-10H | Recombinant Human MED24 protein, MYC/DDK-tagged | +Inquiry |
INSR-1416H | Active Recombinant Human InsR, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELP-1598HCL | Recombinant Human SELP cell lysate | +Inquiry |
FCAR-1929RCL | Recombinant Rat FCAR cell lysate | +Inquiry |
SIGLEC5-1075HCL | Recombinant Human SIGLEC5 cell lysate | +Inquiry |
CHKA-7535HCL | Recombinant Human CHKA 293 Cell Lysate | +Inquiry |
DYRK4-6749HCL | Recombinant Human DYRK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket