Recombinant Full Length Shigella Flexneri Serotype 5B Universal Stress Protein B(Uspb) Protein, His-Tagged
Cat.No. : | RFL18348SF |
Product Overview : | Recombinant Full Length Shigella flexneri serotype 5b Universal stress protein B(uspB) Protein (Q0SZH0) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri serotype 5b |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uspB |
Synonyms | uspB; SFV_3506; Universal stress protein B |
UniProt ID | Q0SZH0 |
◆ Recombinant Proteins | ||
Rrm1-5626M | Recombinant Mouse Rrm1 Protein, Myc/DDK-tagged | +Inquiry |
LOH12CR1-3764H | Recombinant Human LOH12CR1 protein, His-tagged | +Inquiry |
ZFP239-18858M | Recombinant Mouse ZFP239 Protein | +Inquiry |
Tnfrsf23-2111M | Recombinant Mouse Tnfrsf23, Fc Chimera | +Inquiry |
DHX16-10382Z | Recombinant Zebrafish DHX16 | +Inquiry |
◆ Native Proteins | ||
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAGE1-6050HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
C4BPA-8037HCL | Recombinant Human C4BPA 293 Cell Lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
THBS2-1100HCL | Recombinant Human THBS2 293 Cell Lysate | +Inquiry |
LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uspB Products
Required fields are marked with *
My Review for All uspB Products
Required fields are marked with *
0
Inquiry Basket