Recombinant Full Length Shigella Boydii Serotype 4 Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL26425SF |
Product Overview : | Recombinant Full Length Shigella boydii serotype 4 Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q31T72) (20-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella boydii serotype 4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-565) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADEQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVSQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDVWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNHALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANITANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; SBO_4319; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q31T72 |
◆ Recombinant Proteins | ||
FGF2-155H | Recombinant Human FGF2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRPV5-9662M | Recombinant Mouse TRPV5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPO-1123H | Recombinant Human CENPO Protein, GST-Tagged | +Inquiry |
RFL25819DF | Recombinant Full Length Drosophila Yakuba G-Protein Coupled Receptor Mth2(Mth2) Protein, His-Tagged | +Inquiry |
Fhl3-3013M | Recombinant Mouse Fhl3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSG-26490TH | Native Human CTSG | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf33-8103HCL | Recombinant Human C21orf33 293 Cell Lysate | +Inquiry |
PADI3-1274HCL | Recombinant Human PADI3 cell lysate | +Inquiry |
CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Colon-88C | Cynomolgus monkey Colon Lysate | +Inquiry |
ANKS3-26HCL | Recombinant Human ANKS3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket