Recombinant Full Length Yersinia Enterocolitica Serotype O:8 / Biotype 1B Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL11906YF |
Product Overview : | Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A1JIF4) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLPNRHKDKPLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPAIADQLALLQDRVAPFDGALARKHIEIAMGGPLETW FDDFEQEALASASIAQVHTARLKENGQEVVLKVIRPDILPIIKADVRLMYRLAGWVPKLL PDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRESVL VMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP HDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHVDSGWVPCDTNVEDFEF AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELPELVYDSLQQHKLLQQS VDKLTTQMQGQQQRQGQSRYLFGVGATLLVSGTILFLANAVEISIGFIVAGVLAWFIGWR RTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; YE0258; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A1JIF4 |
◆ Recombinant Proteins | ||
FUT8-171HF | Recombinant Full Length Human FUT8 Protein | +Inquiry |
SAP074A-009-4115S | Recombinant Staphylococcus aureus (strain: 433, other: CA-MSSA) SAP074A_009 protein, His-tagged | +Inquiry |
DNAJB14-3026C | Recombinant Chicken DNAJB14 | +Inquiry |
CRLF3-2070HF | Recombinant Full Length Human CRLF3 Protein, GST-tagged | +Inquiry |
ERBB2-2118H | Recombinant Human ERBB2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
COL6-116H | Native Human Collagen type VI | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
Phosphorylase B-49R | Active Native Rabbit Phosphorylase B | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEND5-62HCL | Recombinant Human BEND5 lysate | +Inquiry |
TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
ZDHHC17-194HCL | Recombinant Human ZDHHC17 293 Cell Lysate | +Inquiry |
HECTD3-5590HCL | Recombinant Human HECTD3 293 Cell Lysate | +Inquiry |
KRTAP2-4-4846HCL | Recombinant Human KRTAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket