Recombinant Full Length Salmonella Gallinarum Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL16737SF |
Product Overview : | Recombinant Full Length Salmonella gallinarum Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (B5RFM6) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella gallinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVDA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPSWLMVGGVVVWLV GWRKTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; SG3479; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | B5RFM6 |
◆ Native Proteins | ||
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry |
CRISPLD1-401HCL | Recombinant Human CRISPLD1 cell lysate | +Inquiry |
VPS33A-391HCL | Recombinant Human VPS33A 293 Cell Lysate | +Inquiry |
PIH1D1-1205HCL | Recombinant Human PIH1D1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket