Recombinant Full Length Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL36012EF |
Product Overview : | Recombinant Full Length Apolipoprotein N-acyltransferase(lnt) Protein (Q8FJY4) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT WLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPIMGVEAINFLLMMVS GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDGD QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL PMSSFSRGPYIQPPLSLNGIQLTAAICYEIILGEQVRDNFRPDTDYLLTISNDAWFGKSI GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFTREVLTTNVTPTTGL TPYARTGNWPLWVLTALFGFAAVLMSLRARKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; cutE; c0742; Apolipoprotein N-acyltransferase; ALP N-acyltransferase; Copper homeostasis protein CutE |
UniProt ID | Q8FJY4 |
◆ Recombinant Proteins | ||
JPH2-2350H | Recombinant Human JPH2 Protein, His-tagged | +Inquiry |
MRGPRX2-6362HF | Recombinant Full Length Human MRGPRX2 Protein | +Inquiry |
CTRC-2061M | Recombinant Mouse CTRC Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL8A-1948H | Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SMYD1B-3639Z | Recombinant Zebrafish SMYD1B | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMP4-5215HCL | Recombinant Human IMP4 293 Cell Lysate | +Inquiry |
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
GPS1-5766HCL | Recombinant Human GPS1 293 Cell Lysate | +Inquiry |
RB1CC1-2490HCL | Recombinant Human RB1CC1 293 Cell Lysate | +Inquiry |
LYL1-1042HCL | Recombinant Human LYL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket