Recombinant Full Length Sheep Prostaglandin G/H Synthase 1(Ptgs1) Protein, His-Tagged
Cat.No. : | RFL34487OF |
Product Overview : | Recombinant Full Length Sheep Prostaglandin G/H synthase 1(PTGS1) Protein (P05979) (25-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-600) |
Form : | Lyophilized powder |
AA Sequence : | ADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRP SPSFIHFMLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSN VSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQH FTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPP SVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWG DEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQL YHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHI LHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFY PGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATL KKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGS1 |
Synonyms | PTGS1; COX1; Prostaglandin G/H synthase 1; Cyclooxygenase-1; COX-1; Prostaglandin H2 synthase 1; PGH synthase 1; PGHS-1; PHS 1; Prostaglandin-endoperoxide synthase 1 |
UniProt ID | P05979 |
◆ Recombinant Proteins | ||
PTGS1-6072H | Recombinant Human PTGS1 Protein (Gly367-Leu599), N-His tagged | +Inquiry |
PTGS1-4475R | Recombinant Rat PTGS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGS1-593HFL | Recombinant Full Length Human PTGS1 Protein, C-Flag-tagged | +Inquiry |
Ptgs1-819R | Recombinant Rat Ptgs1 protein, His & T7-tagged | +Inquiry |
RFL34487OF | Recombinant Full Length Sheep Prostaglandin G/H Synthase 1(Ptgs1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGS1-2706HCL | Recombinant Human PTGS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGS1 Products
Required fields are marked with *
My Review for All PTGS1 Products
Required fields are marked with *
0
Inquiry Basket