Recombinant Full Length Sheep Gonadotropin-Releasing Hormone Receptor(Gnrhr) Protein, His-Tagged
Cat.No. : | RFL5041OF |
Product Overview : | Recombinant Full Length Sheep Gonadotropin-releasing hormone receptor(GNRHR) Protein (P32237) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MANGDSPDQNENHCSAINSSILLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSKMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GNRHR |
Synonyms | GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R |
UniProt ID | P32237 |
◆ Native Proteins | ||
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP3CA-001HCL | Recombinant Human PPP3CA cell lysate | +Inquiry |
PIGM-481HCL | Recombinant Human PIGM lysate | +Inquiry |
WBSCR16-1921HCL | Recombinant Human WBSCR16 cell lysate | +Inquiry |
GTF3C3-765HCL | Recombinant Human GTF3C3 cell lysate | +Inquiry |
PPFIBP2-2977HCL | Recombinant Human PPFIBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GNRHR Products
Required fields are marked with *
My Review for All GNRHR Products
Required fields are marked with *
0
Inquiry Basket