Recombinant Full Length Serpentine Receptor Class Epsilon-33(Sre-33) Protein, His-Tagged
Cat.No. : | RFL30113CF |
Product Overview : | Recombinant Full Length Serpentine receptor class epsilon-33(sre-33) Protein (O18175) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MIINSNSSTIFSSIWLPVFFYVEPLDQQVIISILELMIYLVCIHLVNVSLHVALKIRLFH RNLYILALPMFGMWYELIIGKFITIAYRLKLLGLDFELGEHTAIWTNDPGKVLLVASLNG LELLIFGGFLQWHYMYSWIFGVLTVAVERVIASVLIENYESNTQNLMPAILLIISQFLSI SMAFGLLFQKVGPLSAHFPWMISCPISVAAYVFVKKVNESFRREIKNPGRKRIFTLSQQF QVKENLRVLHLGTRLVFAVLSFIGICGCGIAALHYKIVPSYYCHLIENVLFLNPFLIGLT AMLSIPQWKEQFMKSFLTVRLFRNRRKPVHIVVEIEECAKKKNDVETNLYFKQLANSWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sre-33 |
Synonyms | sre-33; W05H5.6; Serpentine receptor class epsilon-33; Protein sre-33 |
UniProt ID | O18175 |
◆ Recombinant Proteins | ||
ATXN3L-174H | Active Recombinant Human ATXN3L, His-tagged | +Inquiry |
TRIM66-231H | Recombinant Human TRIM66 Protein, GST-tagged | +Inquiry |
GNG7-222HF | Recombinant Full Length Human GNG7 Protein | +Inquiry |
VACWR062-3921V | Recombinant Vaccinia virus VACWR062 protein, His-SUMO-tagged | +Inquiry |
Col10a1-350M | Recombinant Mouse Col10a1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
ACT-161R | Native rabbit ACT | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPAIN-2239HCL | Recombinant Human RPAIN 293 Cell Lysate | +Inquiry |
SRFBP1-001HCL | Recombinant Human SRFBP1 cell lysate | +Inquiry |
COX4NB-7333HCL | Recombinant Human COX4NB 293 Cell Lysate | +Inquiry |
THEG-1098HCL | Recombinant Human THEG 293 Cell Lysate | +Inquiry |
USP21-465HCL | Recombinant Human USP21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sre-33 Products
Required fields are marked with *
My Review for All sre-33 Products
Required fields are marked with *
0
Inquiry Basket