Recombinant Full Length Human GNG7 Protein

• Cat.No.: GNG7-222HF
• Product Overview: Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 68 amino acids
• Description: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene.
• Form: Liquid
• Molecular Mass: 33.590kDa inclusive of tags
• AA Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ]
• Official Symbol: GNG7
• Synonyms: GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058
• Gene ID: 2788
• mRNA Refseq: NM_052847
• Protein Refseq: NP_443079
• MIM: 604430
• UniProt ID: O60262