Recombinant Full Length Serpentine Receptor Class Delta-47(Srd-47) Protein, His-Tagged
Cat.No. : | RFL22562CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-47(srd-47) Protein (Q19507) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MYNIILSIFYPIFLALVFPTQIFLFVVVVKYSPKYMQTLRNVLFCNCIFQTISVVLLCLL QLRQVSHLKPMEIWCYGPLRHFEAIISYCLYFVSQSTSVVSNILVLLTIYLKYEAAKNVT NKQSNKCIVIILLLVPVFVLVGAEIYSVVTHSLLPEVRYLFEVINSNVTDHSVIGYITLQ TVPSYLIISIVFGSVFLLPPMGLYTRRKIIFHINSGRDTTSQLKKHQRKTFINGLTLQAC LPLVSLCPIFVCYVIVIGTKSELLFEQYCISVLVLLPTFFDPYITLYSVAPYRKQIGMWL GKAKTGPMIVISSIMNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-47 |
Synonyms | srd-47; F17A2.11; Serpentine receptor class delta-47; Protein srd-47 |
UniProt ID | Q19507 |
◆ Native Proteins | ||
RB5200-3281H | Native Human RB5200 | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
RAB9B-2577HCL | Recombinant Human RAB9B 293 Cell Lysate | +Inquiry |
DCTN3-7041HCL | Recombinant Human DCTN3 293 Cell Lysate | +Inquiry |
INTS9-5187HCL | Recombinant Human INTS9 293 Cell Lysate | +Inquiry |
STARD7-1420HCL | Recombinant Human STARD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srd-47 Products
Required fields are marked with *
My Review for All srd-47 Products
Required fields are marked with *
0
Inquiry Basket