Recombinant Full Length Serpentine Receptor Class Delta-40(Srd-40) Protein, His-Tagged
Cat.No. : | RFL18592CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-40(srd-40) Protein (Q19509) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MGADIYRDVLYIFYPIFFIFSTITQLMLIYLIFYHSPTHLKMLKVFLLNTSLFQIILVVV SCSSQFRMITTAIPIELRSYGLLRYLEAWLGYTMYQVLQTSAFMSGMSILITFVFKYELV RQIEFSKSRVTGIILLFHMPIIASMVMEVIMVINQSLPNEIREQYKFLNANAEEYSIVGA LSLKTVPSLINFLLISGSVVASPFISFFFREKILRRINSQFYQHSKWKKSQIQVFVKGLT IQAFLPLIFYVPVFGLYFYCILTHTEILFQQYFMTVVPCLPAFFDPMLTLYFVTPYRRRL KIWMRIEKESKVLPVTSLVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-40 |
Synonyms | srd-40; F17A2.12; Serpentine receptor class delta-40; Protein srd-40 |
UniProt ID | Q19509 |
◆ Native Proteins | ||
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
KLHL20-943HCL | Recombinant Human KLHL20 cell lysate | +Inquiry |
CCL2-001MCL | Recombinant Mouse CCL2 cell lysate | +Inquiry |
TCEAL8-659HCL | Recombinant Human TCEAL8 lysate | +Inquiry |
MAST4-1009HCL | Recombinant Human MAST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srd-40 Products
Required fields are marked with *
My Review for All srd-40 Products
Required fields are marked with *
0
Inquiry Basket