Recombinant Full Length Serpentine Receptor Class Alpha-23(Sra-23) Protein, His-Tagged
Cat.No. : | RFL5214CF |
Product Overview : | Recombinant Full Length Serpentine receptor class alpha-23(sra-23) Protein (O62367) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFS NSTRLILIVCLLNSVVHQTTVMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTN YFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQFLLAILSFYIAYHGVPLAGYV PMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPL AIYFKTKLTIQNRKLRIAVMISMYGDVGEHIARLKKSWEY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sra-23 |
Synonyms | sra-23; T06G6.1; Serpentine receptor class alpha-23; Protein sra-23 |
UniProt ID | O62367 |
◆ Recombinant Proteins | ||
RFL36698HF | Recombinant Full Length Human Dopamine Beta-Hydroxylase(Dbh) Protein, His-Tagged | +Inquiry |
Ptgs1-819R | Recombinant Rat Ptgs1 protein, His & T7-tagged | +Inquiry |
HNRNPL2-12560Z | Recombinant Zebrafish HNRNPL2 | +Inquiry |
TXN-7003C | Recombinant Chicken TXN | +Inquiry |
SMOC1-2066H | Recombinant Human SMOC1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
F2-1882H | Native Human Coagulation Factor II | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLK-3045HCL | Recombinant Human POLK 293 Cell Lysate | +Inquiry |
ZIC2-166HCL | Recombinant Human ZIC2 293 Cell Lysate | +Inquiry |
FAM19A4-001HCL | Recombinant Human FAM19A4 cell lysate | +Inquiry |
EPHX3-6584HCL | Recombinant Human EPHX3 293 Cell Lysate | +Inquiry |
FXYD6-6097HCL | Recombinant Human FXYD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All sra-23 Products
Required fields are marked with *
My Review for All sra-23 Products
Required fields are marked with *
0
Inquiry Basket