Recombinant Full Length Sensor Protein Zras(Zras) Protein, His-Tagged
Cat.No. : | RFL18713KF |
Product Overview : | Recombinant Full Length Sensor protein ZraS(zraS) Protein (Q9APE0) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella oxytoca |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MNVMRLSKDSVAVGLSWLLTGLILLLVCLFSALIVRDYGRENEAARQTIQEKGSVLIRAL ESGTRVGMGMRMHHSQLQTLLEEMAWQPGVLWFAVTDENGKIIAHSDPRRVGESLYPAST LRELNIGSEERWRRLEQPEPALEIYRQFRPLNGGGHHMRMMMRRESADLRNQAPQVIFIA FDTRELDADHARGLRNMVIMLCAAGVVMAATVLAQFWFRRYQRSRKQLQEATARKEKLVA LGHLAAGVAHEIRNPLSSIKGLAKYFAERTPADGEAHQLALVMAREADRLNRVVSELLEL VRPAHLKYQSVDLNEVITHSLQLVSQDAASRAISLTFTAQPALCRIQADPDRLKQVLLNL YLNAVHAIGREGVITVAVRECGDGRVKVSVADSGKGMTAEQLQAIFTPYFSTKADGTGLG LAVVQNIVEQHGGTIDAESAPGKGALFTFYLPVNGQQKDEQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zraS |
Synonyms | zraS; hydH; Sensor protein ZraS |
UniProt ID | Q9APE0 |
◆ Native Proteins | ||
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
LDL-400H | Native Human Low Density Lipoprotein, High Oxidized | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LZTS3-1418HCL | Recombinant Human LZTS3 cell lysate | +Inquiry |
Radish-706P | Radish Lysate, Total Protein | +Inquiry |
FXYD6-6097HCL | Recombinant Human FXYD6 293 Cell Lysate | +Inquiry |
SNX3-1591HCL | Recombinant Human SNX3 293 Cell Lysate | +Inquiry |
BZW2-8378HCL | Recombinant Human BZW2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zraS Products
Required fields are marked with *
My Review for All zraS Products
Required fields are marked with *
0
Inquiry Basket