Recombinant Full Length Vibrio Splendidus Na(+)-Translocating Nadh-Quinone Reductase Subunit D Protein, His-Tagged
Cat.No. : | RFL25999VF |
Product Overview : | Recombinant Full Length Vibrio splendidus Na(+)-translocating NADH-quinone reductase subunit D Protein (B7VKD5) (1-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio tasmaniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-210) |
Form : | Lyophilized powder |
AA Sequence : | MSSAKEIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTIAVMFVTALSNFFVS LIRNHIPNSVRIIVQMAIIASLVIVVDQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA FAMKSAPIPSFIDGLGNGLGYGFVLITVGFFRELLGSGKLFDMEVLPLVSNGGWYQPNGL MLLAPSAFFLIGFLIWAIRVFKPEQVEAKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrD |
Synonyms | nqrD; VS_0696; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D |
UniProt ID | B7VKD5 |
◆ Recombinant Proteins | ||
LRRTM2-473H | Recombinant Human LRRTM2 Protein, Fc-tagged | +Inquiry |
CNTN4-1609H | Recombinant Human CNTN4 Protein, GST-tagged | +Inquiry |
NR5A1-4436H | Recombinant Human NR5A1 protein, His-tagged | +Inquiry |
CDC25A-1271R | Recombinant Rat CDC25A Protein | +Inquiry |
TDRKH-3214H | Recombinant Human TDRKH protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-295H | Human Liver Membrane Liver Cirrhosis Lysate | +Inquiry |
TMEM25-1125HCL | Recombinant Human TMEM25 cell lysate | +Inquiry |
GOLT1A-300HCL | Recombinant Human GOLT1A lysate | +Inquiry |
TRIM17-1823HCL | Recombinant Human TRIM17 cell lysate | +Inquiry |
NRP2-937HCL | Recombinant Human NRP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nqrD Products
Required fields are marked with *
My Review for All nqrD Products
Required fields are marked with *
0
Inquiry Basket