Recombinant Full Length Sensor Protein Qsec(Qsec) Protein, His-Tagged
Cat.No. : | RFL8045SF |
Product Overview : | Recombinant Full Length Sensor protein qseC(qseC) Protein (Q8Z3P2) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MKLTQRLSLRVRLTLIFLILVSITWAISSFVAWRKTTDNVDELFDTQLMLFARRLSTLDL NELNAPQRMAHTPKKLKHGHIDDDALAFAIFSADGKMLLHDGDNGQDIPYRYRREGFDNG YLKDDNDLWRFLWLNSADGKYRIVVGQEWDYREDMALAIVAAQLTPWLIALPFMLLILLL LLHRELRPLKKLAQALRFRSPESETPLDAKGVPSEVRPLVEALNQLFSRIHSMMVRERRF TSDAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLD SLNNLQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPLLLSLLVRNL LDNAIRYSPQGSVVDVTLHARSFTVRDNGPGVAPEILTHIGERFYRPPGQSVTGSGLGLS IVRRIATLHGMTVSFGNAAEGGFEAVVRW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qseC |
Synonyms | qseC; STY3355; t3099; Sensor protein QseC |
UniProt ID | Q8Z3P2 |
◆ Native Proteins | ||
IgG-334D | Native Donkey IgG | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
VTN-31736TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNL3-5847HCL | Recombinant Human GNL3 293 Cell Lysate | +Inquiry |
BCAM-1438RCL | Recombinant Rat BCAM cell lysate | +Inquiry |
NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
CDC42EP1-322HCL | Recombinant Human CDC42EP1 cell lysate | +Inquiry |
FIZ1-6214HCL | Recombinant Human FIZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All qseC Products
Required fields are marked with *
My Review for All qseC Products
Required fields are marked with *
0
Inquiry Basket