Recombinant Full Length Sensor-Like Histidine Kinase Senx3(Senx3) Protein, His-Tagged
Cat.No. : | RFL21335MF |
Product Overview : | Recombinant Full Length Sensor-like histidine kinase senX3(senX3) Protein (P0A601) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQMLQCIVTLMP LGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGGEDVEFDLSPRKRSATG RSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVANVSHELKTPVGAMALLA EALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSE AISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTI RVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRSNRSQREEELSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | senX3 |
Synonyms | senX3; BQ2027_MB0500; Sensor-like histidine kinase SenX3 |
UniProt ID | P0A601 |
◆ Recombinant Proteins | ||
ERP27-26232TH | Recombinant Human ERP27, His-tagged | +Inquiry |
DsbC-526E | Recombinant E.coli Thiol: Disulfide Interchange Protein DsbC | +Inquiry |
MAPT-50H | Recombinant Human microtubule-associated protein tau Protein, Tag Free, Biotin Labeled | +Inquiry |
Lig1-1318M | Recombinant Mouse Lig1 Protein, MYC/DDK-tagged | +Inquiry |
CTTN-29H | Recombinant Human CTTN protein, DDK-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
Glycated Albumin-006B | Native Bovine Glycated Albumin Protein | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
Placenta-46H | Human Placenta Tissue Lysate | +Inquiry |
KCNK1-5041HCL | Recombinant Human KCNK1 293 Cell Lysate | +Inquiry |
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
TECR-307HCL | Recombinant Human TECR lysate | +Inquiry |
MAOB-4516HCL | Recombinant Human MAOB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All senX3 Products
Required fields are marked with *
My Review for All senX3 Products
Required fields are marked with *
0
Inquiry Basket