Recombinant Full Length Schizosaccharomyces Pombe Upf0588 Membrane Protein C20F10.02C (Spbc20F10.02C) Protein, His-Tagged
Cat.No. : | RFL2082SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe UPF0588 membrane protein C20F10.02c (SPBC20F10.02c) Protein (O42972) (1-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-600) |
Form : | Lyophilized powder |
AA Sequence : | MHRAAAVDTTPKIVFYYKCLLNKNWNEPINNIFWGEFFLLQPRLEVLSQLLRECPKQELT VNGPKFHSMYLYISEILKSKAESLRIRNSLATLQTFLAELSVRKPTDVNFTIFLLLGNID SIDIQFSAFIKNLCQLVKDSEDVQSVEISLRFVLHFVSFLYNSSFISHIYGNYDVFSTLY TVILKRKFGFETAVYAIGLLSACDKFETVNTFRLGLSKIVDEEFFSSVLSSSAQQLISLR DFYVSIKPDNPLTGSFFNLFSLRSSSNNPDSDQESQFSRLPDERATMFFTIYELCCCNKL FLKKLVEGGEKNGEAPLEALLSLLSYINTHQRQSERSHHFSILSLILFHIIIDDRSLLYR LTDKKFKISVRVCSQRYPYPPNATKPATPLGYMLDICCIGIQHNMKLNLSATMYFLYFSF VYRAMTSLVQDGIRMEYHWLELWRVLFSFLDFVSVLINTSPTEDVTRLLELILDVLAYII SNGDALVIRSDELVDLFYKLLHSSKNFSSFSSKIPDERLGALNYLLEVTEYLTSKTVDLP RSTADEVESVIKLELESIPVAKQNAFGGVPPFKESQYRLFHKRASRGMADLLRRKSEAAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC20F10.02c |
Synonyms | SPBC20F10.02c; UPF0588 membrane protein C20F10.02c |
UniProt ID | O42972 |
◆ Recombinant Proteins | ||
RHOX2E-14191M | Recombinant Mouse RHOX2E Protein | +Inquiry |
Rab8a-5332M | Recombinant Mouse Rab8a Protein, Myc/DDK-tagged | +Inquiry |
Acot12-1498M | Recombinant Mouse Acot12 Protein, Myc/DDK-tagged | +Inquiry |
Spike-21S | Recombinant SARS-CoV-2 Spike Trimer (S1+S2) (BA.5, Omicron Variant), C-His-tagged | +Inquiry |
Bdnf-703M | Recombinant Mouse Bdnf Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1849U | Active Native Ulex Europaeus Agglutinin I Protein, Agarose bound | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2B3-6671HCL | Recombinant Human EIF2B3 293 Cell Lysate | +Inquiry |
OVCAR4-053WCY | Human Ovarian Adenocarcinoma OVCAR4 Whole Cell Lysate | +Inquiry |
LMBR1L-4717HCL | Recombinant Human LMBR1L 293 Cell Lysate | +Inquiry |
WASF1-368HCL | Recombinant Human WASF1 293 Cell Lysate | +Inquiry |
ZGPAT-168HCL | Recombinant Human ZGPAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC20F10.02c Products
Required fields are marked with *
My Review for All SPBC20F10.02c Products
Required fields are marked with *
0
Inquiry Basket