Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Transporter C22E12.01(Spac22E12.01, Spac890.09) Protein, His-Tagged
Cat.No. : | RFL6016SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized transporter C22E12.01(SPAC22E12.01, SPAC890.09) Protein (Q10354) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | METDPILKVEREPEFTPSPAPEAIVKDIEQGVAPVSQNEPDRPQHWITRVVIIVLIVLAW YFFSLLLSMMNKWIFSESKMDFQFPLFLSSCQMLVQMGFAKLTILAFPRYQPNKKDNFSW LEYFYRAGICALVTGLDIGLSNASLETITLSFYTMCRSSILIFVFFFSVIFRIEMFDWIL LCITLVISAGVVLMVATETQFVLSGFLLVMASSVLSGLRWALTQKLLLDHPWTSNPFTSL FALTPLMFLFLLVAGLIFEGPVRFIESPAWKEFGPFMSVVILVPGTLAFFMVASEFGLIQ KTSIVTLSVCGILKEIITIIASTLFYHDILLPINIVGLVITLCGIGVYNYYRITKGNKKE AEKEVEYIVLNENA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC22E12.01 |
Synonyms | SPAC22E12.01; SPAC890.09; Uncharacterized transporter C22E12.01 |
UniProt ID | Q10354 |
◆ Native Proteins | ||
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWF1-633HCL | Recombinant Human TWF1 293 Cell Lysate | +Inquiry |
RHOG-542HCL | Recombinant Human RHOG lysate | +Inquiry |
IFRD1-5277HCL | Recombinant Human IFRD1 293 Cell Lysate | +Inquiry |
POLM-3043HCL | Recombinant Human POLM 293 Cell Lysate | +Inquiry |
KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC22E12.01 Products
Required fields are marked with *
My Review for All SPAC22E12.01 Products
Required fields are marked with *
0
Inquiry Basket