Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein Wtf21(Wtf21) Protein, His-Tagged
Cat.No. : | RFL33359SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein wtf21(wtf21) Protein (O74474) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MKNNYTSLKSPLDEEDELKTDHEIDLEKGPLPEYDSEEEGALPPYSDHALVNNPPNTHRE NNPSRSTDNSSPFLIKLLISFTPIYVLNVLAICYLTYKDAFFKDYGAAEWTLFGFWCLVC TLALIFLTYFYETWVKAVKVTVISLAKCVKVISIGLFNIRREMMIIIWILWLIICCILFV YIKSGDLILNKALICSTCTISAVLLLIVSSVCIPFWTFERTLAKLAKVLLLQSGIVLVLN GTMFLRGKHFERIGCEIEASVLFIMGNVLFLCEMECPGALIRTRNSIRNGIAFILGGIGN AMMGLANAIRGANDNNDIPLGEMDVESEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | wtf21 |
Synonyms | wtf21; wtf3; SPCC1739.15; Meiotic drive suppressor wtf21 |
UniProt ID | O74474 |
◆ Native Proteins | ||
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
CFH-115H | Active Native Human Factor H | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE4B-556HCL | Recombinant Human UBE4B 293 Cell Lysate | +Inquiry |
APBB1IP-29HCL | Recombinant Human APBB1IP lysate | +Inquiry |
LIFR-2285MCL | Recombinant Mouse LIFR cell lysate | +Inquiry |
ANG-20HCL | Recombinant Human ANG lysate | +Inquiry |
RPL24-2214HCL | Recombinant Human RPL24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All wtf21 Products
Required fields are marked with *
My Review for All wtf21 Products
Required fields are marked with *
0
Inquiry Basket