Recombinant Full Length Arabidopsis Thaliana Cbs Domain-Containing Protein Cbscbspb3(Cbscbspb3) Protein, His-Tagged
Cat.No. : | RFL9706AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CBS domain-containing protein CBSCBSPB3(CBSCBSPB3) Protein (Q9LF97) (1-556aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-556) |
Form : | Lyophilized powder |
AA Sequence : | MSTQATGPSSTSGRRSNSTVRRGPPPSKKPVQSENGSVNGNTSKPNSPPPQPQSQAPSNG ERTVKKLRLSKALTIPEGTTVFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIA EGLRPDQTLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVVENGEVIALLDITKCL YDAISRMEKAAEQGSALAAAVEGVEKQWGSGYSAPYAFIETLRERMFKPALSTIITDNSK VALVAPSDPVSVAAKRMRDLRVNSVIISTGNKISGILTSKDILMRVVAQNLSPELTLVEK VMTPNPECASLETTILDALHTMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSS GAVNDMANTMMQKFWDSALALEPPDDSDTQSEMSAMMHHSDIGKLSSYPSLGLGNSFSFK FEDLKGRVHRFTSGAENLEELMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDL VGAVTLARSTGQKVLRLHLDFTESTRSLSSETTQLKKGDSRDRGSGWVSWRGGVVVTGAV VLTSIAIVVYLKRSKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSCBSPB3 |
Synonyms | CBSCBSPB3; At3g52950; F8J2_120; CBS domain-containing protein CBSCBSPB3 |
UniProt ID | Q9LF97 |
◆ Recombinant Proteins | ||
EGFR-102M | Recombinant Mouse EGFR protein(Met1-Ser647), hFc-tagged | +Inquiry |
Pilrb1-810M | Active Recombinant Mouse Pilrb1 Protein, His-tagged | +Inquiry |
DDX19B-2537HF | Recombinant Full Length Human DDX19B Protein, GST-tagged | +Inquiry |
EEF1D-805H | Recombinant Human EEF1D Protein, His (Fc)-Avi-tagged | +Inquiry |
DSG1-144HF | Recombinant Full Length Human DSG1 Protein | +Inquiry |
◆ Native Proteins | ||
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
PLG -37D | Native Canine plasminogen | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
◆ Cell & Tissue Lysates | ||
Esophagus-122C | Cynomolgus monkey Esophagus Lysate | +Inquiry |
UBE2E3-581HCL | Recombinant Human UBE2E3 293 Cell Lysate | +Inquiry |
BCMO1-8474HCL | Recombinant Human BCMO1 293 Cell Lysate | +Inquiry |
MMGT1-864HCL | Recombinant Human MMGT1 cell lysate | +Inquiry |
IL18R1-2587HCL | Recombinant Human IL18R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBSCBSPB3 Products
Required fields are marked with *
My Review for All CBSCBSPB3 Products
Required fields are marked with *
0
Inquiry Basket