Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C8F11.08C(Spac8F11.08C) Protein, His-Tagged
Cat.No. : | RFL18267SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C8F11.08c(SPAC8F11.08c) Protein (Q9UT29) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MGFATILYSIWVVLSSFVILSAYQLEVRKFLVKLLSKIVIGASESNVASFFAFVSEKSLE AASVKFVATIIAERMGAQFSSFYDKIFFVDMLGLGSLFALAAVNVLAARKLESELPASLE PSIGNRDQQKNSSLAKCFSRLFINDLHGTTVKRYPYISYLPNWLLAKNNAERLVYKSHLL LNAYSPPKSASASSVIVWVCGAKKSESIIIPYLSSLGFFVVVPNYAQPPKFPLSDAVEFV SLCVDWIVENAIYYDADPERIFFLGEDTGASVALESLKHIRPNSVKGIFALCPRSIQNLV WTNQSTIPMMTLHAGDVNPVSDSNDRESSEKASLIKNFVVPGAVPYYYEFTSPRTISTAT FIARWFFLVEDNKKTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC8F11.08c |
Synonyms | SPAC8F11.08c; Uncharacterized protein C8F11.08c |
UniProt ID | Q9UT29 |
◆ Recombinant Proteins | ||
IDH1-2640R | Recombinant Rat IDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FADS1-2933M | Recombinant Mouse FADS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25246MF | Recombinant Full Length Mouse Protein Gpr108(Gpr108) Protein, His-Tagged | +Inquiry |
M-4370H | Recombinant HMPV(strain CAN97-83) M protein, His&Myc-tagged | +Inquiry |
CLEC4G-2685H | Recombinant Human CLEC4G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
DEF-196H | Native Human Defensins | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYG2-768HCL | Recombinant Human GYG2 cell lysate | +Inquiry |
CPBT-56409RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
UBL5-553HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
LCA5-4810HCL | Recombinant Human LCA5 293 Cell Lysate | +Inquiry |
ATAT1-7996HCL | Recombinant Human C6orf134 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC8F11.08c Products
Required fields are marked with *
My Review for All SPAC8F11.08c Products
Required fields are marked with *
0
Inquiry Basket