Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C7D4.09C (Spac7D4.09C) Protein, His-Tagged
Cat.No. : | RFL25793SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C7D4.09c (SPAC7D4.09c) Protein (O14264) (1-274aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-274) |
Form : | Lyophilized powder |
AA Sequence : | MQLLNNWYSLLLTEVAAYFTSTTLFVSILKNAPSLSWLMKYGGHDNFGLKPPLIATKLEV PKRWFWHFYAFISLLNPLFTFFILNTNFPIPIFKNIKEDLMYSKKLQVLLLIYEIHTLRR LYENLRFRKSGSKMLAGHYLLGYLFYTHTFLALLLCGRRSYENTMSSMQFVGLGIYAIGS IWQNASHEHLIAQKNHSQYLVLKKGCFKWITGPHYLGEIIVYTGIALIAQHWLIWLVLGW VLCNMVAISSSYACTVKNKEQSLDFRWTLIPFLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC7D4.09c |
Synonyms | SPAC7D4.09c; Uncharacterized protein C7D4.09c |
UniProt ID | O14264 |
◆ Native Proteins | ||
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
LPA-8453H | Native Human LPA | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
C22orf39-8089HCL | Recombinant Human C22orf39 293 Cell Lysate | +Inquiry |
CHIT1-2533HCL | Recombinant Human CHIT1 cell lysate | +Inquiry |
HLA-DOA-5502HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
ATPBD4-8570HCL | Recombinant Human ATPBD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC7D4.09c Products
Required fields are marked with *
My Review for All SPAC7D4.09c Products
Required fields are marked with *
0
Inquiry Basket