Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C1002.01(Spac1002.01, Spac1610.05) Protein, His-Tagged
Cat.No. : | RFL23073SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C1002.01(SPAC1002.01, SPAC1610.05) Protein (Q9US57) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MLPPTIRISGLAKTLHIPSRSPLQALKGSFILLNKRKFHYSPFILQEKVQSSNHTIRSDT KLWKRLLKITGKQAHQFKDKPFSHIFAFLFLHELSAILPLPIFFFIFHSLDWTPTGLPGE YLQKGSHVAASIFAKLGYNLPLEKVSKTLLDGAAAYAVVKVSYFVENNMVSSTRPFVSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC1002.01 |
Synonyms | SPAC1002.01; SPAC1610.05; Uncharacterized protein C1002.01 |
UniProt ID | Q9US57 |
◆ Native Proteins | ||
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
PTA-23B | Active Native Bacillus stearothermophilus Phosphotransacetylase | +Inquiry |
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORAI2-3554HCL | Recombinant Human ORAI2 293 Cell Lysate | +Inquiry |
MCRS1-4411HCL | Recombinant Human MCRS1 293 Cell Lysate | +Inquiry |
FAIM3-753HCL | Recombinant Human FAIM3 cell lysate | +Inquiry |
GSTT1-312HCL | Recombinant Human GSTT1 lysate | +Inquiry |
DPYSL5-509HCL | Recombinant Human DPYSL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC1002.01 Products
Required fields are marked with *
My Review for All SPAC1002.01 Products
Required fields are marked with *
0
Inquiry Basket