Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Amino-Acid Permease C9.10(Spac9.10) Protein, His-Tagged
Cat.No. : | RFL34226SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized amino-acid permease C9.10(SPAC9.10) Protein (Q9UT18) (1-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-591) |
Form : | Lyophilized powder |
AA Sequence : | MPSSQISHQDPELGQTSSGSSSIKEKAEPQLYAGPIDPARRPDVFQEGFEDVSVTDDDND NELLRKMGYQPVLHRSFEFFESFAASFASLDVVSGVRLTFSWGISFGGPAAYWSAMLVTG FCSIVTAACLAEICSALPAAGSIYLWAAESAGPRFGRFVSFLVAWWSTTAWTTFVASITQ STANFIFAEVSTFNNPWPTNDSDVKFRAVQWIVAEVLLVFTILLNQVPPRYYKWIFKASM LLMFIDYVMNIIWVPVATSKKPDGFRSAKWVFTETIYDQAGYIKEVDDANGNPIASLSKI VPKGWQWCLSYFATAGVIVGYDASGHIAEETKDASIKAARGIFYSTVTSFIVAFSLAILY LFCCPDLDTFTAILYNDNSPQPFVNFYSYLLGRGGHVVMNVVIILEIFLNGVVSVLACSR LVFAVSRDGVLPFSNWISQVSKTGQPKNAITVIYIVSALLLCTILPSAVAFTSLVSAAGA PSFAAYAVLAFCRLFITRDKFPKGRWSLGWLSKPCLVITLVYNLFALVVNVSPYTYPVTG PSFNYAVVIMGGVSIFAIICTIVIPKSRWVANRYRYESDSEHSASVKELKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | thi9 |
Synonyms | thi9; SPAC9.10; Thiamine transporter thi9 |
UniProt ID | Q9UT18 |
◆ Native Proteins | ||
APOB-216H | Native Human APOB Protein | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
Mucin-078P | Native Porcine Mucin Protein | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebral Meninges-75R | Rhesus monkey Cerebral Meninges Lysate | +Inquiry |
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
GNA12-719HCL | Recombinant Human GNA12 cell lysate | +Inquiry |
LMOD1-4706HCL | Recombinant Human LMOD1 293 Cell Lysate | +Inquiry |
C5orf56-8006HCL | Recombinant Human C5orf56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All thi9 Products
Required fields are marked with *
My Review for All thi9 Products
Required fields are marked with *
0
Inquiry Basket