Recombinant Full Length Prochlorococcus Marinus Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL2885PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Cytochrome c biogenesis protein CcsB(ccsB) Protein (A9BCE8) (1-429aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-429) |
Form : | Lyophilized powder |
AA Sequence : | MKVLWRVLNWLSSLKVAILLLFFIALASAIGTFIPQGDQSDNYINNYAKHPWLGLINGHL ILRMQLDHVYSSYWFLFLLSWLGIALMICSWRRQWPTLKAAMKWIDYDQSTQIKKLAISE EVIVQDSGLAIKKLHNQLISSGWDVKADSNRIAARKGVIGRFGPPLVHFGLIFLMIGATL GALEGQRVEKFLEPGKSIDLISPDGINKLKIKLKDFQILRLPNGQPEQFLSKVELSDGSN QQPISREISVNHPLRFQGLTIYQADWALSGINMQFGNSPKLQLPLKAIPELGEQVWGISL PDLDNAGKSILLTISSETGPARFYSQEGKSITEITPGGNKEIINGLETQVIEVLQSSGIL IKYDPGVPLVYIGFAITLIGSLISIISTKMLWALWEEENGLLFIGGLSNRNLSGFANDFP TLLKVIKSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; P9211_15791; Cytochrome c biogenesis protein CcsB |
UniProt ID | A9BCE8 |
◆ Native Proteins | ||
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
Lectin-1839S | Active Native Sambucus Nigra Lectin Protein, Cy3 labeled | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM11-1481HCL | Recombinant Human RBM11 cell lysate | +Inquiry |
SLC31A1-1736HCL | Recombinant Human SLC31A1 293 Cell Lysate | +Inquiry |
PCDHB13-3393HCL | Recombinant Human PCDHB13 293 Cell Lysate | +Inquiry |
SEC61B-1578HCL | Recombinant Human SEC61B cell lysate | +Inquiry |
TMSB4X-904HCL | Recombinant Human TMSB4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket