Recombinant Full Length Schizosaccharomyces Pombe Sphingosine N-Acyltransferase Lac1(Lac1) Protein, His-Tagged
Cat.No. : | RFL342SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Sphingosine N-acyltransferase lac1(lac1) Protein (O59735) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MGNNTSRRSQSQKFKNIPSISAGSFSTMPVQHRGRRRRSKSIVGRAAQNAVLRSKEKTWI VPLILLTLLVGWYFVNPNGYIKYGIFLSYPIPGTNPAQYGKGRLDIAFCLFYALFFTFCR EFIMQEIIARIGRHFNIRAPAKLRRFEEQAYTCLYFTVMGSWGLYVMKQTPMWFFNTDAF WEEYPHFYHVGSFKAFYLIEAAYWIQQALVLILQLEKPRKDFKELVVHHIITLLLIGLSY YFHFTWIGLAVFITMDTSDIWLALSKCLNYVNTVIVYPIFVIFVFVWIYMRHYLNFKIMW AVWGTMRTINSFDLDWAAEQYKCWISRDVTLILLTALQLVNIYWLILILRIGYRAFTTND THDERSEDEDEEVSDEKSSAKKND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lac1 |
Synonyms | lac1; mug83; SPBC3E7.15c; SPBC4F6.02c; Sphingosine N-acyltransferase lac1; Meiotically up-regulated gene 83 protein |
UniProt ID | O59735 |
◆ Recombinant Proteins | ||
WWOX-2287C | Recombinant Chicken WWOX | +Inquiry |
Gfra2-360M | Recombinant Mouse Gfra2 Protein, His-tagged | +Inquiry |
PLEKHD1-12951M | Recombinant Mouse PLEKHD1 Protein | +Inquiry |
PQBP1-5715H | Recombinant Human PQBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL7362SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Ygr026W (Ygr026W) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27345TH | Native Human SNCA | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
TPO-442HCL | Recombinant Human TPO cell lysate | +Inquiry |
MAP3K7-1056HCL | Recombinant Human MAP3K7 cell lysate | +Inquiry |
IQCF1-5177HCL | Recombinant Human IQCF1 293 Cell Lysate | +Inquiry |
Stomach-124M | Mouse Stomach Tissue Lysate (14 Day Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lac1 Products
Required fields are marked with *
My Review for All lac1 Products
Required fields are marked with *
0
Inquiry Basket