Recombinant Full Length Schizosaccharomyces Pombe Putative Metal Ion Transporter C17A12.14 (Spac17A2.14, Spac17G6.01) Protein, His-Tagged
Cat.No. : | RFL8959SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Putative metal ion transporter C17A12.14 (SPAC17A2.14, SPAC17G6.01) Protein (O13779) (1-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-617) |
Form : | Lyophilized powder |
AA Sequence : | MPSNTSRSVPTGFYYKQNARMQNRPRFSDRKHSSKSKHRFPVDPSLQPDEADEGTRLLGN SDSDLLEPPSEHSSNGEDDKDINNPPSMPSSVCSSPKSPHRHYESDEDIENISLPESHPE DIQRKEFETENGKNTRDQPSPLAEVSDFAISSPHVYPKSANSHDSHYEQFANNDVTESAV DDHPATRKLSRDELYLPISPNNAQEPKFSVLDEWTKKMVANFEEYSVEDVDKRRERNRKL SEPLLVNGRYRVRDRWAQFRKSEIEKPYRFTFFTDELPSTIHSHEMWELVHDGQSFEDLF HSGGTWWLDVSCPKEEEIRVLAKAFGIHPLTVEDITLEEDREKVELFRTYYFVTFRSFNQ LPSNSEYLKPLNFYLVVFRDGIITFHMNPTPHPANVRRRIRQLNGYLTVNADWIAYALLD DTTDAFAPFIEQIEDEVDTIDSMILSIHYDHVMEVKPQERMLQRVGECRKLIMSLLRLLA NKADVVRGLSKRCNESWQVAPRGEIALYLGDVQDHIVTMVQNLNHYEKILSRSHSNYLAQ ISINMTLVSNETNEVLSRLTILGTILIPLNLVTGLWGMNVKVPGQDVPGLGWFFSILGSL MIFAISSFILCKWYKVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC17A2.14 |
Synonyms | SPAC17A2.14; SPAC17G6.01; Putative metal ion transporter C17A12.14 |
UniProt ID | O13779 |
◆ Recombinant Proteins | ||
HSD3B7-13966H | Recombinant Human HSD3B7 protein, GST-tagged | +Inquiry |
Cd59-8764R | Recombinant Rat Cd59 protein(Met1-Asn100), hFc-tagged | +Inquiry |
TSPAN7B-7161Z | Recombinant Zebrafish TSPAN7B | +Inquiry |
TGFBR1-716H | Recombinant Human TGFBR1, GST-His | +Inquiry |
RARB-2511H | Active Recombinant Full Length Human RARB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDKRB1-8471HCL | Recombinant Human BDKRB1 293 Cell Lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
NPHS2-1211HCL | Recombinant Human NPHS2 cell lysate | +Inquiry |
CDC14C-177HCL | Recombinant Human CDC14C lysate | +Inquiry |
SLC14A1-1803HCL | Recombinant Human SLC14A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC17A2.14 Products
Required fields are marked with *
My Review for All SPAC17A2.14 Products
Required fields are marked with *
0
Inquiry Basket