Recombinant Full Length Schizosaccharomyces Pombe Putative Arrestin-Related Trafficking Adapter C839.02(Spbc839.02) Protein, His-Tagged
Cat.No. : | RFL14126SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Putative arrestin-related trafficking adapter C839.02(SPBC839.02) Protein (Q8WZK5) (1-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-530) |
Form : | Lyophilized powder |
AA Sequence : | MYIPNLRNYHDKVFPYGPSSNGYNPVIRLTDRTTQPDPSQHIYQEEKISKCEGLSYRARE WLLLSSNSNARVAIALAEPVLYLPGATSSEIQSEHSAVLRGSLCIQIYKPVKLKKIQLSF KGKSRTEWPEGIPPKLFDTYEENSIMNHCWVFFHSEQKVDENSHGAVWYKVLPHYADTAH YPRSMECFYPGEYVYNFELPISCTYPESIQTDMGRVYYFLETLVDRSSTFSGKSTGRIPI ELIRSPCSTSVATSEPILVSKSWEDRLHYEVQVGEKCVVMGQVVPVNFKFTLLGEVKFHK LRLFLMERRYYYCRQRSVRRKEKTRQLLLYERSAPKNQCLLSDWKQVRPDVYELSDQVRI PGCHDMAANIVHFDTTYPNIKITHTVRTVLRFSCENSPELMGSAKYLEIYIDSPVRLLSC RCSDGSTMLPAYCPIIPSSEVNFCSIDNRIIAGMNRDLALDSDIIGNSPPSFDSWTAVPY QAPPPKYDDIFQSGSSHDENHDDNYFINIFIIFLIIKHMCLITKMFLGLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC839.02 |
Synonyms | SPBC839.02; Putative arrestin-related trafficking adapter SPBC839.02 |
UniProt ID | Q8WZK5 |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLRN1-7432HCL | Recombinant Human CLRN1 293 Cell Lysate | +Inquiry |
CSN1S1-411HCL | Recombinant Human CSN1S1 cell lysate | +Inquiry |
TMEM179B-983HCL | Recombinant Human TMEM179B 293 Cell Lysate | +Inquiry |
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
SEMA5A-1860HCL | Recombinant Human SEMA5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPBC839.02 Products
Required fields are marked with *
My Review for All SPBC839.02 Products
Required fields are marked with *
0
Inquiry Basket