Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily C Member 1(Kcnc1) Protein, His-Tagged
Cat.No. : | RFL5946RF |
Product Overview : | Recombinant Full Length Rat Potassium voltage-gated channel subfamily C member 1(Kcnc1) Protein (P25122) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH HSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTR ERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnc1 |
Synonyms | Kcnc1; Potassium voltage-gated channel subfamily C member 1; NGK2; RAW2; Voltage-gated potassium channel subunit Kv3.1; Voltage-gated potassium channel subunit Kv4 |
UniProt ID | P25122 |
◆ Recombinant Proteins | ||
Gcsam-3177M | Recombinant Mouse Gcsam Protein, Myc/DDK-tagged | +Inquiry |
LILRB4-392C | Recombinant Cynomolgus LILRB4 protein, Mouse IgG2a Fc-tagged | +Inquiry |
MAPK3-28H | Recombinant human biotinylated ERK1, His-tagged | +Inquiry |
TNFRSF10D-0737H | Recombinant Human TNFRSF10D protein, His-tagged | +Inquiry |
MURC-10260M | Recombinant Mouse MURC Protein | +Inquiry |
◆ Native Proteins | ||
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM11-796HCL | Recombinant Human TRIM11 293 Cell Lysate | +Inquiry |
IL23R-1429CCL | Recombinant Cynomolgus IL23R cell lysate | +Inquiry |
ZCRB1-197HCL | Recombinant Human ZCRB1 293 Cell Lysate | +Inquiry |
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
GRID1-310HCL | Recombinant Human GRID1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnc1 Products
Required fields are marked with *
My Review for All Kcnc1 Products
Required fields are marked with *
0
Inquiry Basket