Recombinant Full Length Schizosaccharomyces Pombe Probable Sterol O-Acyltransferase 2(Are2) Protein, His-Tagged
Cat.No. : | RFL27655SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Probable sterol O-acyltransferase 2(are2) Protein (Q9UU82) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MIAATPAKSKPSDVNLEQTFKGVSETSKIDLRRSRAAYRPLELSPTPSIFARNYQRNAVD FTGFFVLFWVAVSIMIFMSFLENFELTGRPVVGTIFKYFQSNLLDLAKADLAMSSMFLLA FPFQKIFALGYLRWYGLGVYLYSILILLFLSHCVLRCCLSNWSWTHRAMFILHSMVILMK LHSYNVVNGWYSYCYHSLNKLQSKKTDLDDDERSSVEFYEHCLNHHGNTYPENLTIPNAL DFLFMPSLCYQLYYPRTAHVRIHYLIECALGTFGCIFLLVIISDHFMVPVLAKAIRTIIE APEDASATYFAIRLGHTVAFLMFPFMLSFLLVFWVIFEGVCNFSAEITRFADRNFYDDWW NCWTWDQFARTWNKPVHYFLLRHVYVPLNSFMSKSLSTFFTFFVSSVLHELVMGCITLKI RGYGLFFQMTQIPYIIIQRQKFVRRHRLLGNIAFWFSIIIGIALIAALYILF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | are2 |
Synonyms | are2; SPCP1E11.05c; Probable sterol O-acyltransferase 2; Sterol-ester synthase 2 |
UniProt ID | Q9UU82 |
◆ Recombinant Proteins | ||
PPIA-4005C | Recombinant Chicken PPIA | +Inquiry |
EPHA2-227H | Recombinant Human EPHA2 protein, His-tagged | +Inquiry |
WT1-625H | Recombinant Human WT1 Protein, His-tagged | +Inquiry |
SNX9-536HFL | Recombinant Full Length Human SNX9 Protein, C-Flag-tagged | +Inquiry |
APOA1-303C | Recombinant Cynomolgus APOA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEPREL4-1563HCL | Recombinant Human LEPREL4 cell lysate | +Inquiry |
CCDC7-7752HCL | Recombinant Human CCDC7 293 Cell Lysate | +Inquiry |
ZNF37A-2019HCL | Recombinant Human ZNF37A cell lysate | +Inquiry |
P2RX7-3495HCL | Recombinant Human P2RX7 293 Cell Lysate | +Inquiry |
THBS3-1099HCL | Recombinant Human THBS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All are2 Products
Required fields are marked with *
My Review for All are2 Products
Required fields are marked with *
0
Inquiry Basket