Recombinant Full Length Schizosaccharomyces Pombe Peroxisomal Membrane Protein Pex32(Pex32) Protein, His-Tagged
Cat.No. : | RFL11278SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Peroxisomal membrane protein pex32(pex32) Protein (O59807) (1-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-535) |
Form : | Lyophilized powder |
AA Sequence : | MIRAHLFSEPDNSKLWAKSTGSDAFDLILKVLLWTAPWYYCLTTLFFTWLIILYPRPTLA CSVAAWLFWFTSLDTLEPDDRKNTLKASEAVSTSAKTSEETAKPSETREDGEWNTLKNTL EADAQNLMSGFQMLQRRWSQPKTTTLKTEVKEQQASQSPSVEGENEPAGVKSNEATKPSV TEEKEKNAEQNKRRERLSISHIVTELAKKDEVSSESGSNEIVNAKLKNEQLDSNFTLLDA YLEPLVHLHEYSRRSNTLFFFYLPIVMSILIFCLPTQALFIVLSSVFLAWHSPPLQAVLF CIRRISFFNLLYEKFVIGKTKEPAKPVPQPSSNEPPAPSAENKQPSVSSPEKKESPATHL LKVIGSSPYVVHSNHTNNTLTDKESSDPTEKCLYLIEHQRYWVGVGWLNRTLPTDPPNFT NAGSTDPVAEPTAQLLPPDGLAWIDDKWSISPWTFTDTFWAQPAKTQFRTAFTRSREWRR RYRVAPPAENEKPHTSRTNTASSLSSTSEDQVSTHGSISSAKVTAIPDSNGAEAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pex32 |
Synonyms | pex32; SPCC550.09; Peroxisomal membrane protein pex32; Peroxin-32 |
UniProt ID | O59807 |
◆ Recombinant Proteins | ||
RFL11219RF | Recombinant Full Length Rat Serine Palmitoyltransferase Small Subunit A(Sptssa) Protein, His-Tagged | +Inquiry |
SPOCK3-15917M | Recombinant Mouse SPOCK3 Protein | +Inquiry |
CYCS-78M | Recombinant Mouse CYCS Protein, His-tagged | +Inquiry |
PVR-614H | Recombinant Human PVR protein, His-Avi-tagged | +Inquiry |
ULK2-1115H | Recombinant Human Unc-51-Like Kinase 2 (C. elegans), GST-tagged | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREBZF-199HCL | Recombinant Human CREBZF lysate | +Inquiry |
Daudi-3H | Human Daudi lysate | +Inquiry |
LRRIQ3-1031HCL | Recombinant Human LRRIQ3 cell lysate | +Inquiry |
ODF2-3598HCL | Recombinant Human ODF2 293 Cell Lysate | +Inquiry |
ICA1-5316HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pex32 Products
Required fields are marked with *
My Review for All pex32 Products
Required fields are marked with *
0
Inquiry Basket