Recombinant Full Length Schizosaccharomyces Pombe Gpi Transamidase Component Pig-S Homolog(Spac1F12.09) Protein, His-Tagged
Cat.No. : | RFL2974SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe GPI transamidase component PIG-S homolog(SPAC1F12.09) Protein (Q10351) (1-554aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-554) |
Form : | Lyophilized powder |
AA Sequence : | MSPCKWLTMFLKGCWGKIANMNHLDSCFPLRYIIGRKKASKLLCTMDSGLKSDSHEVERS NFQLNKPEKSLKRYALLSFYVIILLAIPVWWKTTHYERSSLPFEDMENAPSTVQTHLRFS PTFRILDDKGNNLTKEVQKVLEAEPQIYSYNLKVLEDDPVDYRIVLRESTDLQWFWDENN FIIDTPSKGPSELAILIVNCLWEAFSPQVMEVWSKFTRFSSTVEPSRAETKRTVQFSPQY RVLLSLLVGEGNHEPINWDIENAIQKYFNPLIEQLASLAKLNIETQIQYFVEDAEAYIKD DKFCTKHADLPNLVNNFEKYLSFSPHIREPTIHFVLYVPSPQIQPLWLENEDSNIIPTNS MLLPQWGSITTINFNVTEKKLLHDVDLKDYFRVISRDLLLLLGINDVPVSSLSATLADRL LRQRIAESCIEASDTLQNLAKLVHSMQSMAVPKEIQMYVKDTLLSLDMAYKALSQNNLNE ALSYSNNAFSKSQEALFHPSMVTTIYFPDESKYGIYAPLFAPILIPLLISFIKEVKDMLR ERKLHRVANVPKPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpi17 |
Synonyms | gpi17; SPAC1F12.09; GPI transamidase component PIG-S homolog |
UniProt ID | Q10351 |
◆ Recombinant Proteins | ||
SWAP70-2847C | Recombinant Chicken SWAP70 | +Inquiry |
RFL28325BF | Recombinant Full Length Uncharacterized Membrane Protein Yoyd(Yoyd) Protein, His-Tagged | +Inquiry |
ISYNA1-2311R | Recombinant Rhesus monkey ISYNA1 Protein, His-tagged | +Inquiry |
CERKL-1547H | Recombinant Human CERKL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SE0023-1429S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0023 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-31158TH | Native Human TF | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2V1-560HCL | Recombinant Human UBE2V1 293 Cell Lysate | +Inquiry |
Lung-314P | Porcine Lung Lysate | +Inquiry |
ZNF671-2072HCL | Recombinant Human ZNF671 cell lysate | +Inquiry |
NR0B2-3722HCL | Recombinant Human NR0B2 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpi17 Products
Required fields are marked with *
My Review for All gpi17 Products
Required fields are marked with *
0
Inquiry Basket