Recombinant Full Length Schizosaccharomyces Pombe Gpi Transamidase Component Gaa1(Gaa1) Protein, His-Tagged
Cat.No. : | RFL3612SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe GPI transamidase component gaa1(gaa1) Protein (Q9US48) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MSLFTFVQIRVFPFLQRHLFFLQLSLTLIGLSWIFILPRNEIIDRLHVSESALLPGQVNT YFENRYSKTVSSSLTAANTWSHLDASVGTNTMYDDLEQIFTAMGLPTQKQNYSINIPGSE FNGSNFITTLRAPRGDATESLLLCVPWKDHIGQYNEAGVALAISLLKYFQGWSLWSKDII LVIFDDPVYGPSSFLTSYFDQTTPYISYTPLKIRSGSIQAGLSLELVTTENNSDVLEVLY QATNGQLPNLDLFNTISRIFMQHFNYPLRLQGYDFHANSGSSYTSRLKSLWMGMLTQAVS NVTSAHALFPQYRIDMLTLRMKVKDPFSFDMFRFGQAIESTFRSLNNLLEHLHQSFFFYF ILDHLHFISIGNYMPSILILAASFMLGAYRHWINHEKKIDLWRPFSFWLFSIFCTIAAYY LVSSSTKITVFIFLYLMLTFIGIIFSTFMTSEDAELVLSYDLMSKSLFISVVSTLNFSLS FVVAILLVPLQFISFRFNRRLSLLFAVLTYFSTFIFLCSLSKILNGPLVPFWLWAKEYEL FNSWLMPSVFMILVLPEIIFSVTSFFSLWNEPSVKTKTKTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gaa1 |
Synonyms | gaa1; SPAC1002.11; GPI transamidase component gaa1 |
UniProt ID | Q9US48 |
◆ Recombinant Proteins | ||
RASA1-6148H | Recombinant Human RASA1 Protein (Pro403-Leu596), N-His tagged | +Inquiry |
NDUFB5-480C | Recombinant Cynomolgus Monkey NDUFB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18556XF | Recombinant Full Length Xenopus Tropicalis Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged | +Inquiry |
TXNDC17-317H | Recombinant Human TXNDC17 protein(Met1-Asp123) | +Inquiry |
MAP2K1-3215R | Recombinant Rat MAP2K1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-5410H | Native Human Vitronectin | +Inquiry |
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM30A-688HCL | Recombinant Human TMEM30A lysate | +Inquiry |
FDFT1-6271HCL | Recombinant Human FDFT1 293 Cell Lysate | +Inquiry |
TMEM217-686HCL | Recombinant Human TMEM217 lysate | +Inquiry |
CYP46A1-7105HCL | Recombinant Human CYP46A1 293 Cell Lysate | +Inquiry |
ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gaa1 Products
Required fields are marked with *
My Review for All gaa1 Products
Required fields are marked with *
0
Inquiry Basket