Recombinant Full Length Schizosaccharomyces Pombe Gpi Mannosyltransferase 3(Gpi10) Protein, His-Tagged
Cat.No. : | RFL19536SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe GPI mannosyltransferase 3(gpi10) Protein (Q9USN0) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MRIWFWLAILVFRWWNALWVKTFFQPDEFYQSLEVAHHFIFRYGFLTWEWTSAIRSALHP LIFAALYRVLQVLKLDSSYFVFTNAPKLLQGTFAAILDYGTYKFALVRYGSKTANWTLAC SLVSIMNAYVGVRTFSNSLETTLTSIGFYYFSYYLKYENSSPEQRKKAYSSLLGFISVAA FACFIRPTNILVWIFPLLFWNKNPQTPIKDLLSFSNVFNRFRFLYALGYGRLFGIFVLCV SLFLVNIIADRILYGRFVFPIISFFQFNVTSGLSSLYGLNAWHYYLSQALPLICGGFLPF VLLTMDLQTAGTILCVFFPYSLIGHKELRFVYPISPILLTLAGKFFSSFSSWKRAARFFF LIGLGHALVITFLCRFHQFGVMEVMPLIHSLAEKNQTGLILAPCHTTPWQSHIHSPFAEN GWKFLTCEPFEKPFDETDRFYENMPTFLDKIKEWPDYLIFFEERFYSLYSYLDSRGLKYE EVQRYYNSLIPESRERAGALLVYKKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpi10 |
Synonyms | gpi10; SPCC16A11.06c; GPI mannosyltransferase 3; GPI mannosyltransferase III; GPI-MT-III; Glycosylphosphatidylinositol-anchor biosynthesis protein 10 |
UniProt ID | Q9USN0 |
◆ Recombinant Proteins | ||
CTDSPL2-2270HF | Recombinant Full Length Human CTDSPL2 Protein, GST-tagged | +Inquiry |
TMPRSS2-30144TH | Recombinant Human TMPRSS2 | +Inquiry |
GIMAP6-4904H | Recombinant Human GIMAP6 Protein, GST-tagged | +Inquiry |
POLR2C-647H | Recombinant Human POLR2C Protein, GST-His-tagged | +Inquiry |
RUNX1-3870R | Recombinant Rhesus Macaque RUNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
F9-301R | Native Rat Factor IXa | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGM2L1-3250HCL | Recombinant Human PGM2L1 293 Cell Lysate | +Inquiry |
HL-60-044HCL | Human HL-60 Cell Nuclear Extract | +Inquiry |
CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
PPP2CB-2928HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
D2HGDH-7088HCL | Recombinant Human D2HGDH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpi10 Products
Required fields are marked with *
My Review for All gpi10 Products
Required fields are marked with *
0
Inquiry Basket