Recombinant Full Length Schizosaccharomyces Pombe Glucose Receptor Protein Git3(Git3) Protein, His-Tagged
Cat.No. : | RFL22601SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Glucose receptor protein git3(git3) Protein (O94744) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MLHLDYTFNVSDATSTSSIIIVSRRELANLRIMVIIASAISIVFSLIAIFWRWSRRRTIR EQFHIALFSVLFIRSIVQMIHPCLALSDPFFWAPKHRCFTIGFFLLVLVRMTDYWIFINI LHNALLVLFPHVDTERRGLYRFRHTVFTLSFVIPLTIGGLAFTNKRNTFVNLQTRCYLPY TPVRFMFGLNWSFDYALSIAIIALQTCMFISIRRKIKRFKKYSHQQTNVFDTLNVIDSYP TAPDQVALPPFPDTNSTLTYTPSNSQSIYSSQSQPSPYSRPLLSSVHPNLPPGSQSTPAN LNQSGIHFEQDFRDSPNRTNGLEDHTSFKLSSPLTSDEDGASSVLAAYGNDMQDDPLLKQ RKRILSQSKFLFAYPAIFIFMWILPQIQIIVILAQPLHCSGSCKRFAFVAVFADNFVAIF IALSDFIWICYRGYTYLKERDSSKSYWDQIKELTLKWWRGKFGEEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | git3 |
Synonyms | git3; SPCC1753.02c; Glucose receptor protein git3; Glucose-insensitive transcription protein 3 |
UniProt ID | O94744 |
◆ Recombinant Proteins | ||
TEK-40H | Active Recombinant Human TEK protein (R915C), GST-tagged | +Inquiry |
HYAL4-1973H | Active Recombinant Human Hyaluronoglucosaminidase 4, His-tagged | +Inquiry |
DCST1-2933HF | Recombinant Full Length Human DCST1 Protein, GST-tagged | +Inquiry |
PTDSS2-13630M | Recombinant Mouse PTDSS2 Protein | +Inquiry |
RNASEK-14275M | Recombinant Mouse RNASEK Protein | +Inquiry |
◆ Native Proteins | ||
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A15-1706HCL | Recombinant Human SLC6A15 293 Cell Lysate | +Inquiry |
HAVCR1-2394RCL | Recombinant Rat HAVCR1 cell lysate | +Inquiry |
ITIH1-882HCL | Recombinant Human ITIH1 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
PHF6-3225HCL | Recombinant Human PHF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All git3 Products
Required fields are marked with *
My Review for All git3 Products
Required fields are marked with *
0
Inquiry Basket